Recombinant Human CCL5, biotinylated, Biotin
Catalog Number:
QBS-50181PB-50
Article Name: |
Recombinant Human CCL5, biotinylated, Biotin |
Biozol Catalog Number: |
QBS-50181PB-50 |
Supplier Catalog Number: |
50181PB-50 |
Alternative Catalog Number: |
QBS-50181PB-50-50 |
Manufacturer: |
QED Bioscience |
Category: |
Proteine/Peptide |
Species Reactivity: |
Human |
Conjugation: |
Biotin |
Alternative Names: |
rHuCCL5-biotin, Rantes |
Recombinant human CCL5, produced in E. coli, corresponds to aa 24-91 |
Concentration: |
Lot Specific |
UniProt: |
P13501 |
Source: |
Recombinant human CCL5, produced in E. coli |
Purity: |
>97% by SDS-PAGE |
Form: |
Lyophilized. |
Sequence: |
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMS |
Target: |
CCL5ylated |
Antibody Type: |
Recombinant Antibody |
Application Dilute: |
Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water. |