Recombinant Human CCL27

Catalog Number: QBS-50182P-5
Article Name: Recombinant Human CCL27
Biozol Catalog Number: QBS-50182P-5
Supplier Catalog Number: 50182P-5
Alternative Catalog Number: QBS-50182P-5-5
Manufacturer: QED Bioscience
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: rHuCCL27, CTACK
Recombinant human CCL27, produced in E. coli, corresponds to aa 25- 112
Concentration: Lot Specific
Molecular Weight: 10.149 kDa
UniProt: Q9Y4X3
Source: Recombinant human CCL27, produced in E. coli
Purity: >97%
Form: Lyophilized.
Sequence: FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQ RSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Target: CCL27
Antibody Type: Recombinant Antibody
Application Dilute: Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.