Recombinant Human CCL28
Catalog Number:
QBS-50183P-100
| Article Name: |
Recombinant Human CCL28 |
| Biozol Catalog Number: |
QBS-50183P-100 |
| Supplier Catalog Number: |
50183P-100 |
| Alternative Catalog Number: |
QBS-50183P-100-100 |
| Manufacturer: |
QED Bioscience |
| Category: |
Proteine/Peptide |
| Species Reactivity: |
Human |
| Alternative Names: |
rHuCCL28, MEC |
| Recombinant human CCL28, produced in E. coli, corresponds to aa 23- 127 |
| Concentration: |
Lot Specific |
| Molecular Weight: |
12.073 kDa |
| UniProt: |
Q9NRJ3 |
| Source: |
Recombinant human CCL28, produced in E. coli |
| Purity: |
>97% |
| Form: |
Lyophilized. |
| Sequence: |
ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRR ICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQG KHETYGHKTPY |
| Target: |
CCL28 |
| Antibody Type: |
Recombinant Antibody |
| Application Dilute: |
Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water. |
