Recombinant Human CCL28, biotinylated, Biotin
Catalog Number:
QBS-50183PB-10
Article Name: |
Recombinant Human CCL28, biotinylated, Biotin |
Biozol Catalog Number: |
QBS-50183PB-10 |
Supplier Catalog Number: |
50183PB-10 |
Alternative Catalog Number: |
QBS-50183PB-10-10 |
Manufacturer: |
QED Bioscience |
Category: |
Proteine/Peptide |
Species Reactivity: |
Human |
Conjugation: |
Biotin |
Alternative Names: |
rHuCCL28-biotin, MEC |
Recombinant human CCL28, produced in E. coli, corresponds to aa 23- 127 |
Concentration: |
Lot Specific |
Molecular Weight: |
14.3 kDa |
UniProt: |
Q9NRJ3 |
Source: |
Recombinant human CCL28, produced in E. coli |
Purity: |
>97% |
Form: |
Lyophilized. |
Sequence: |
ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRR ICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQG KHETYGHKTPY |
Target: |
CCL28ylated |
Antibody Type: |
Recombinant Antibody |
Application Dilute: |
Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water. |