Recombinant Human CCL28, biotinylated, Biotin

Catalog Number: QBS-50183PB-10
Article Name: Recombinant Human CCL28, biotinylated, Biotin
Biozol Catalog Number: QBS-50183PB-10
Supplier Catalog Number: 50183PB-10
Alternative Catalog Number: QBS-50183PB-10-10
Manufacturer: QED Bioscience
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Biotin
Alternative Names: rHuCCL28-biotin, MEC
Recombinant human CCL28, produced in E. coli, corresponds to aa 23- 127
Concentration: Lot Specific
Molecular Weight: 14.3 kDa
UniProt: Q9NRJ3
Source: Recombinant human CCL28, produced in E. coli
Purity: >97%
Form: Lyophilized.
Sequence: ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRR ICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQG KHETYGHKTPY
Target: CCL28ylated
Antibody Type: Recombinant Antibody
Application Dilute: Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.