The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
Form:
1mg of peptide supplied as a lyophilized powder.
Formula:
1mg of peptide supplied as a lyophilized powder.
* VAT and and shipping costs not included. Errors and price changes excepted
