VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, CAS [[2279952-25-7]] Preis auf Anfrage

Product Overview

• Article Name: VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, CAS [[2279952-25-7]] Preis auf Anfrage
• Biozol Catalog Number: TGM-T76250
• Supplier Catalog Number: T76250
• Alternative Catalog Number: TGM-T76250-5MG, TGM-T76250-50MG
• Manufacturer: TargetMol
• Category: Biochemikalien

Product Description

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of alpha2delta-1 and is recognized as the alpha2delta-1Tat peptide. It disrupts the alpha2delta-1 - NMDAR interaction both in vitro and in vivo, offering a potential research tool for neuropa

Product Properties

• Molecular Weight: 3490.06
• CAS Number: [2279952-25-7]
• Formula: C171H250N40O39