SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, Tag-free, E. coli

Catalog Number: TRZ-P2020-019_100
Article Name: SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, Tag-free, E. coli
Biozol Catalog Number: TRZ-P2020-019_100
Supplier Catalog Number: P2020-019_100
Alternative Catalog Number: TRZ-P2020-019_100
Manufacturer: trenzyme
Host: E. coli
Category: Biochemikalien
Application: ELISA, WB
Species Reactivity: Virus
Alternative Names: 3CL Mpro, 3CL Pro, 3CL protease, 3C-like main protease, SARS-CoV-2, coronavirus, 2019-nCoV, COVID-2019, COVID-19, covid-19, sars-cov-2
The new coronavirus SARS-CoV-2 expresses two proteases, the papain-like protease (PLpro) and 3C-like protease (3CLpro). Both belong to the group of cysteine proteases, as they have a cysteine residue at their catalytic site. Their main function is the processing of the viral polyprotein, that contains two cleavage sites to build up the viral replicase complex. Additionally, PLpro has the ability of removing ISG15 and ubiquitin from viral proteins expressed in the cell, this enables evasion from the innate immune response by the host. This represents an interesting target for drug development. This is because it not only would inhibit viral replication, but would also prevent the massive immunological response that results from the over-activation of the host’s immune system. Such an over-activation can lead to damage of the uninfected cells and thus to a worsening of the patient’s condition. N-terminal His-Tag was removed to restore protease activity.
Molecular Weight: 36,0 kDa
UniProt: P0DTD1
Buffer: PBS, contains Glycerol as protectant
Purity: > 90% as determined by SDS-PAGE
Form: liquid
Sequence: SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE PLTQDHVDIL
Formula: pH 7,4
SDS-Page of SARS-CoV-2 (COVID-19) 3CL-Mpro Protein Tag-free
Structural model of 3CL-Mpro Protein Tag-free