human ACE2 Protein (ECD, processed) - tag-free, lyophilized formulation, Human

Catalog Number: TRZ-P2020-024_1000
Article Name: human ACE2 Protein (ECD, processed) - tag-free, lyophilized formulation, Human
Biozol Catalog Number: TRZ-P2020-024_1000
Supplier Catalog Number: P2020-024_1000
Alternative Catalog Number: TRZ-P2020-024_1000
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: hACE2, ACEH, human angiotensin-converting enzyme 2, ACE-related carboxypeptidase, Angiotensin-converting enzyme homolog, Metalloprotease MPROT15
The human Angiotensin-Converting Enzyme 2 (hACE2) is a type I transmembrane metallocarboxypeptidase with homology to ACE, a regulator in the Renin-Angiotensin system (RAS) and long-known as a target for the treatment of hypertension. hACE2 is highly expressed at the surface of cells of the human lungs, arteries, kidneys, heart and intestine – all tissues shown to harbor SARS-CoV. The function of ACE2 is known as controlling blood pressure. This is accomplished by the hydrolysis of a small peptide hormone called Angiotensin II into the nonapeptide Angiotensin 1-9, which is thereafter converted into the heptapeptide angiotensin 1-7 by ACE and other endopeptidases. Angiotensin 1-7 acts in a vasoconstricting manner and is believed to be one of the main effectors in controlling the blood pressure and is therefore involved in pathophysiological processes like diabetes, hypertension and cardiac function in general. Recently it became known, that the new Coronavirus SARS-CoV-2 uses ACE2 as the entry point into alveolar cells of the lungs, where it replicates and causes the Coronavirus disease (COVID-19).
Molecular Weight: 80,0 kDa
UniProt: Q9BYF1
Buffer: 50 mM Tris, 250 mM NaCl
Purity: > 80% as determined by SDS-PAGE. If maximum activity is needed, we recommend ordering our protein as liquid formulation (P2020-016)
Form: lyophilized
Sequence: MTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP IGCLPAHLLG
Formula: pH 8,0