SARS-CoV-2 S1 (RBD) Kappa B.1.617.1 (India), Fc/His-Tag

Catalog Number: TRZ-P2020-047_100
Article Name: SARS-CoV-2 S1 (RBD) Kappa B.1.617.1 (India), Fc/His-Tag
Biozol Catalog Number: TRZ-P2020-047_100
Supplier Catalog Number: P2020-047_100
Alternative Catalog Number: TRZ-P2020-047_100
Manufacturer: trenzyme
Category: Biochemikalien
Species Reactivity: Virus
Alternative Names: L452R), 501.V2, VUI-202012/01, B.1.617, B1617, B.1.617.1, B16171, B.1.617.2, B16172, B.1.617.3, B16173, Indian Variant, , E484Q, L452R, SARS-CoV-2, coronavirus, SARS-CoV-2 spike RBD, SARS-CoV-2 spike protein, 2019-nCoV, COVID-2019, COVID-19, RBD (E484Q,
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors. The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called B.1.617, exhibits 13 mutations. Compared to the previously circulating variants, the mutations L452R and E484Q of the SARS-CoV-2 Spike S1 (RBD) may cause a stronger affinity of the spike protein to hACE2 and also conferring an increasing ability to evade the hosts’ immune system.
Molecular Weight: 38,9 kDa
UniProt: P0DTC2
Buffer: PBS
Purity: > 90% as determined by SDS-PAGE
Form: liquid
Sequence: MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTF KCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYrYRLFRKSNLKPFERDISTEIYQAGSTPCNGVqGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Formula: pH 7,4
Structural model of SARS-CoV-2 S1 (RBD) Kappa B1.617.1 (India) Fc His-Tag