SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India), GFP/His-Tag

Catalog Number: TRZ-P2020-049_100
Article Name: SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India), GFP/His-Tag
Biozol Catalog Number: TRZ-P2020-049_100
Supplier Catalog Number: P2020-049_100
Alternative Catalog Number: TRZ-P2020-049_100
Manufacturer: trenzyme
Category: Biochemikalien
Species Reactivity: Virus
Alternative Names: SARS-CoV-2, coronavirus, SARS-CoV-2 spike RBD, SARS-CoV-2 spike protein, 2019-nCoV, COVID-2019, COVID-19, RBD (L452R, T478K), 501.V2, VUI-202012/01, B.1.617, B1617, B.1.617.1, B16171, B.1.617.2, B16172, B.1.617.3, B16173, Indian Variant, , E484Q, T478K,
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors. The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A new SARS-CoV-2 lineage called B.1.617, exhibits 13 mutations. Compared to the previously circulating variants, the mutations L452R and T478K of the SARS-CoV-2 Spike S1 (RBD) may cause a stronger affinity of the spike protein to hACE2 and also conferring an increasing ability to evade the hosts’ immune system.
Molecular Weight: 52,9 kDa
UniProt: P0DTC2
Buffer: PBS
Purity: > 85% as determined by SDS-PAGE
Form: liquid
Sequence: MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFST FKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAW NSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSY GFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Formula: pH 7,4
Structural model of SARS-CoV-2 S1 (RBD) Delta B.1.617.2 (India) GFP/His-Tag