Influenza A - G4 EA H1N1 Haemagglutinin Protein - HA1 Subunit

Catalog Number: TRZ-P2020-100_100
Article Name: Influenza A - G4 EA H1N1 Haemagglutinin Protein - HA1 Subunit
Biozol Catalog Number: TRZ-P2020-100_100
Supplier Catalog Number: p2020-100_100
Alternative Catalog Number: TRZ-P2020-100_100
Manufacturer: trenzyme
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Virus
Alternative Names: H1N1, HA1, Hemagglutinin of Influenza A
Recently, a prevalent Eurasian avian-like H1N1 swine influenza virus with a potential pandemic concern was described in the journal Proceedings of the National Academy of Science (PNAS). The described genotype 4 (G4) reassortant Eurasian avian-like (EA) H1N1 virus was found in Chinese pigs and has become predominant since 2016. According to the report (Sun et. al., 2020, PNAS), similar to the pandemic 2009 H1N1 virus, G4 viruses bind to human-type receptors and therefore have the correct characteristics to cause human infections. The G4 EA H1N1 viruses have the ability to grow well in human lung cells and show efficient infectivity and aerosol transmission in ferrets. In their study (Sun et. al., 2020, PNAS), the researchers were able to show that approximately 10% of swine workers (n=338) and 4% of 230 people from the general population in China were seropositive for the G4 EA H1N1 virus. This indicated that the virus has acquired increased human infectivity and therefore greatly enhanced the possibility of virus adaptation in humans. Experts believe, that pre-existing population immunity does not provide protection against G4 viruses. Moreover, according to scientists, the G4 viruses are diverse enough that seasonal flu vaccines would unlikely provide protection or prevent a human-to-human transmission. Until now, there have been no reports of G4 viruses spreading from human to human – a characteristic that is required for classification as a pandemic. Nevertheless, controlling the prevalent G4 EA H1N1 virus in pigs and monitoring the swine worker populations are very important. Indeed, systematic surveillance of influenza viruses in pigs is a key measure for early warning and preparing for the next potential pandemic, as was demonstrated by the emergence of the 2009 pandemic. Therefore, it is very important to be prepared and to develop antibody tests or vaccines, for detecting a potential G4 EA H1N1 virus outbreak in humans and to have the right medicine ready.​
Molecular Weight: 38,9 kDa
Buffer: PBS
Purity: > 85% as determined by SDS-PAGE
Form: liquid
Sequence: DTICVGYHANNSTDTVDTILEKNVTVTHSVNLLENSHNGKLCSLNGKIPLQLGNCNVAGW ILGNPKCDLLLTANSWSYIIETSNSKNGACYPGEFADYEELKEQLSTVSSFERFEIFPKA TSWPNHDTTRGTTVACSHSGANSFYRNLLWIVKKGNSYPKLSKSYTNNKGKEVLVIWGVH HPPTDSDQQTLYQNNHTYVSVGSSKYYKRFTPEIVARPKVREQAGRMNYYWTLLDQGDTI TFEATGNLIA
Formula: pH 7,4
SDS-Page of Influenza A G4 EA H1N1 Haemagglutinin Protein HA1 Subunit
Structural model of Influenza A G4 EA H1N1 Haemagglutinin Protein HA1 Subunit