hCELA3A, His-Tag

Catalog Number: TRZ-P2020-102_1000
Article Name: hCELA3A, His-Tag
Biozol Catalog Number: TRZ-P2020-102_1000
Supplier Catalog Number: P2020-102_1000
Alternative Catalog Number: TRZ-P2020-102_1000
Manufacturer: trenzyme
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: Chymotrypsin-like elastase family member 3A, Elastase IIIA, Elastase-3A, ELA3, ELA3A, Protease E, OTTHUMP00000002835, elastase 3A, pancreatic
Chymotrypsin-like elastases (CELAs) are pancreatic serine proteinases, which belong to the peptidase S1 family, a subfamily of serine proteases. The human CELA3A is a member of the elastase family, which consists of six human elastase genes encoding the proteins elastase 1, 2, 2A, 2B, 3A, and 3B, all of which are structurally similar. Typically, elastases hydrolyze many proteins in addition to elastin. However, CELA3A has only little elastolytic activity. CELA3A is secreted by the pancreas and characterized by a digestive function in the intestine, very similar to other serine proteases such as trypsin, chymotrypsin and kallikrein.
Molecular Weight: 30,0 kDa
UniProt: P09093
Buffer: PBS
Purity: > 90% as determined by SDS-PAGE
Form: liquid
Sequence: YGPPSSHSSSR_VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH
Formula: pH 7,4
SDS-Page of hCELA3A His-Tag
Structural model of hCELA3A His-Tag