pro-TGF-beta 1, GFP/His-Tag, Human

Catalog Number: TRZ-P2020-118_100
Article Name: pro-TGF-beta 1, GFP/His-Tag, Human
Biozol Catalog Number: TRZ-P2020-118_100
Supplier Catalog Number: p2020-118_100
Alternative Catalog Number: TRZ-P2020-118_100
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Species Reactivity: Human
Alternative Names: Latent TGF-beta1, small latent TGF-beta1 complex, Transforming growth factor beta-1 proprotein, Latency-associated peptide, Transforming growth factor beta 1, TGF-beta1
Transforming growth factor beta 1 or TGF-β1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, and apoptosis. The transforming growth factor beta-1 is synthesized as precursor consisting of the latency-associated peptide (LAP, 249 aa) and the transforming growth factor beta 1 (112 aa). The precursor is also named small latend complex (SLC) or latent TGF-ß1. The precursor proprotein is cleaved in the Golgi apparatus by Furin, but the disulfide-linked homodimers of LAP and TGF-beta 1 remain non‑covalently associated after secretion. TGF-ß1 activation from latency is controlled both spatially and temporally, by multiple pathways that include actions of proteases such as plasmin and MMP9, and/or by thrombospondin 1 or selected integrins. Once activated following release of LAP, TGF-beta-1 acts by binding to TGF-beta receptors (TGFBR1 and TGFBR2), which transduce signals. Mutations within the LAP are associated with Camurati-Engelmann disease, a rare sclerosing bone dysplasia characterized by inappropriate presence of active TGF-beta 1. To increase the functionality for diagnostics and other applications, the LAP is fused to GFP.
Molecular Weight: 71,4 kDa
UniProt: P01137
Buffer: PBS
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: MLSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPG PLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSI YMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSD SPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIH GMNRPFLLLMATPLERAQHLQSSRHRR
Formula: pH 7,4
SDS-Page of pro-TGF-beta 1 GFP/His-Tag
Structural model of pro-TGF-beta 1 GFP/His-Tag