Furin, GFP/His-Tag, Human

Catalog Number: TRZ-P2020-119_100
Article Name: Furin, GFP/His-Tag, Human
Biozol Catalog Number: TRZ-P2020-119_100
Supplier Catalog Number: P2020-119_100
Alternative Catalog Number: TRZ-P2020-119_100
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: Furin (Paired Basic Amino Acid Cleaving Enzyme), PCSK3, PACE, FUR, SPC1, Paired Basic Amino Acid Residue-Cleaving Enzyme, EC 3.4.21.75, Paired Basic Amino Acid Cleaving Enzyme (Furin, Membrane Associated Receptor Protein), Proprotein Convertase Subtilisi
Furin, also known as paired basic Amino acid Cleaving Enzyme (PACE) is a ubiquitous subtilisin-like proprotein convertase with a minimal cleavage site of Arg-X-X-Arg˅. However, the enzyme prefers the site Arg-X-Lys/Arg-Arg˅. It is the major processing enzyme of the secretory pathway and is localized in the trans-golgi network where it functions to cleave other proteins into their mature/active forms. Substrates of Furin include blood clotting factors, serum proteins and growth factor receptors such as the insulin-like growth factor receptor but also viral proteins like the SARS-CoV-2 Spike protein. Furin is inhibited by EGTA, α1- Antitrypsin Portland and polyarginine compounds.
Molecular Weight: 103,7 kDa
UniProt: P09958
Buffer: PBS
Purity: > 85% as determined by SDS-PAGE
Form: liquid
Sequence: MQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVS
Formula: pH 7,4
SDS-Page of Furin GFP/His-tag
Structural model of Furin GFP/His-tag