Lanmodulin (LanM), E. coli

Catalog Number: TRZ-P2020-126_100
Article Name: Lanmodulin (LanM), E. coli
Biozol Catalog Number: TRZ-P2020-126_100
Supplier Catalog Number: P2020-126_100
Alternative Catalog Number: TRZ-P2020-126_100
Manufacturer: trenzyme
Host: E. coli
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Bacteria
Alternative Names: Lanmodulin, Lanthanides, Lns
Lanthanides (Lns) are essential cofactors in certain enzymes. Lanmodulin (LanM) is a metal binding protein found in several lanthanide-utilizing, methylotrophic bacteria like Methylorubrum sp. The protein exhibits unique metal-binding properties and binds rare-earth elements (REEs) with very high affinity, often better than many synthetic chelators. LanM-REE complexes are stable at extreme conditions like high temperature, repeated acid treatments down to pH 2.5 and up to molar amounts of competing non-REE metal ions. Therefore, lanmodulin could be used even in harsh chemical processes for selective recovery of a broad range of REE from precumbustion coal and electronic waste leachates.
Molecular Weight: 14,9 kDa
UniProt: B1ZIE8
Buffer: PBS
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: MAFRLSSAVLLAALVAAPAYAAPTTTTKVDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARELASPAGSALVNLIR
Formula: pH 7,4
SDS-Page of Lanmodulin lanM
Structural model of Lanmodulin lanM