Catalase, E. coli

Catalog Number: TRZ-P2020-127_100
Article Name: Catalase, E. coli
Biozol Catalog Number: TRZ-P2020-127_100
Supplier Catalog Number: P2020-127_100
Alternative Catalog Number: TRZ-P2020-127_100
Manufacturer: trenzyme
Host: E. coli
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: H. pylori
Alternative Names: KatA
Catalases are conserved and abundant enzyme found in all domains of life. They protect against oxidative stress and are highly expressed. In the gastric pathogen Helicobacter pylori, KatA levels are estimated to be up to 4-5% of the total protein content. The presence of the enzyme is ubiquitous, it could be detected in the cytoplasm, the periplasm and on the cell surface as well as being readily detected extracellularly. The enzyme is described to use heme as cofactor. KatA is used as biomarker for duodenal ulcer (DU) and also for gastritic cancer (GC).
Molecular Weight: 86,9 kDa
UniProt: P77872
Buffer: PBS
Purity: > 75% as determined by SDS-PAGE
Form: liquid
Sequence: MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGSGAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTEEGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNHDMVWDFWSNVPESLYQVTWVMSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKYDPDSNQRDLFNAIARGD
Formula: pH 7,4
SDS-Page of Catalase
Structural model of Catalase