human Interleukin-1 beta, tag-free, E. coli

Catalog Number: TRZ-P2020-136_20
Article Name: human Interleukin-1 beta, tag-free, E. coli
Biozol Catalog Number: TRZ-P2020-136_20
Supplier Catalog Number: p2020-136_20
Alternative Catalog Number: TRZ-P2020-136_20
Manufacturer: trenzyme
Host: E. coli
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: IL-1 beta, Catabolin, IL-1B, IL-1 beta Protein, IL1-BETA Protein, IL1F2 Protein
The pro-inflammatory cytokine Interleukin-1 beta (IL-1 beta) is produced by a variety of cell types, including macrophages, dendritic cells, fibroblasts, endothelial cells and keratinocytes. Activation of IL-1 beta is tightly regulated as it is first produced as inactive precursor in response to infection or cell injury and has to be proteolytically cleaved by caspase-1, which is activated by a cytosolic pro-inflammatory signaling complex, the inflammasome. Proteolytic cleavage of pro-IL-1 beta results in secretion of mature IL-1 beta and induction of inflammatory responses by binding to the IL-1 type I receptor (IL-1RI). In particular, activation of IL-1 beta induces inflammation, fever, synthesis of acute phase proteins, as well as proliferation and differentiation of lymphocytes emphasizing its versatile biological functions. Activity is further regulated by several endogenous inhibitors including IL-1 type II receptor (IL-1RII) and IL-1 receptor antagonist (IL-1Ra). Dysregulation causes pathological conditions ranging from chronic inflammatory and autoinflammatory diseases to autoimmune syndromes, neurodegenerative diseases and cancer.
Molecular Weight: 17,6 kDa
UniProt: P01584
Buffer: PBS
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Formula: pH 7,4