blueTEV, lyophilized formulation, E. coli

Catalog Number: TRZ-P2020-137_200U
Article Name: blueTEV, lyophilized formulation, E. coli
Biozol Catalog Number: TRZ-P2020-137_200U
Supplier Catalog Number: P2020-137_200U
Alternative Catalog Number: TRZ-P2020-137_200U
Manufacturer: trenzyme
Host: E. coli
Category: Biochemikalien
Application: ELISA, FA, WB
Alternative Names: TEV Protease, TEV, Tobacco Etch Virus nuclear-inclusion-a endopeptidase, rTEV, P1 protease, EC 3.4.22.44
blueTEV represents the catalytic domain of the nuclear inclusion a (NIa) protein with a molecular weight of 27 kDa encoded by the plant virus Tobacco Etch Virus. "blue" indicates fusion of the protease to blue fluorescent protein (BFP), which leads to increased stability and solubility of TEV protease. Moreover, blueTEV has been optimized by site directed mutagenesis to prevent autocatalytic cleavage. blueTEV is a highly site-specific cysteine protease that recognizes the amino acid sequence Glu-Asn-Leu-Tyr-Phe-Gln-(Gly/Ser) [ENLYFQ(G/S)] and cleaves between the residues Gln and Gly/Ser. The most commonly used recognition sequence is ENLYFQG. In biotechnology, blueTEV is a versatile enzyme to remove affinity tags from recombinant proteins with high specificity and activity over a wide range of pH, ionic strength and temperatures between 4 °C and 30 °C. The optimal temperature for cleavage is 30 °C. It is recommended to improve cleavage efficiency for each fusion protein by varying the amount of recombinant blueTEV, reaction time, or incubation temperature. The great advantage of blueTEV is its facile removal after cleavage reaction by immobilized metal affinity chromatography (IMAC) since it is equipped with a His-tag. Furthermore, the removal of blueTEV can be monitored instantly by detection of fluorescence in solution - this easy, fast and sensitive method omits time-consuming SDS-PAGE or Western blot analysis. If the blue fluorescence of blueTEV is not suitable and you prefer green fluorescence as readout, check our greenTEV protease.
Molecular Weight: 53,7 kDa
UniProt: Q0GDU8
Buffer: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 5% Trehalose
Purity: > 85% as determined by SDS-PAGE
Form: lyophilized
Sequence: KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
Formula: pH 8,0