human BCMA, Fc/His-Tag, Human

Catalog Number: TRZ-P2020-148_100
Article Name: human BCMA, Fc/His-Tag, Human
Biozol Catalog Number: TRZ-P2020-148_100
Supplier Catalog Number: P2020-148_100
Alternative Catalog Number: TRZ-P2020-148_100
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: TNFRSF17, Tumor necrosis factor receptor superfamily member 17, CD269, CD antigen CD269, BCM, BCMA, B-cell maturation protein
B cell maturation antigen (BCMA), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a transmembrane glycoprotein crucial for the survival and function of B lymphocytes, particularly plasma cells. Signaling via BCMA is induced by binding to its ligands, a B cell activating factor (BAFF) and a proliferation-inducing ligand (APRIL), both of which are essential for B cell survival, maturation, and differentiation. BCMA has gained significant attention in the context of hematologic malignancies, particularly multiple myeloma. Aberrant expression of BCMA on myeloma cells contributes to the survival and proliferation of these malignant plasma cells. Therefore, a variety of therapeutic approaches targeting BCMA, such as bispecific antibody constructs, antibody-drug conjugates (ADCs), and chimeric antigen receptor (CAR)-modified T cell therapy, have been developed and revealed promising results in preclinical and clinical studies. Despite the progress in BCMA-targeted therapies, challenges regarding resistance mechanisms and relapse need to be further addressed.
Molecular Weight: 34,9 kDa
UniProt: Q02223
Buffer: PBS
Purity: > 95 % as determined by SDS-PAGE
Form: liquid
Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Formula: pH 7,4