OFCC1, Recombinant, Human, aa3-231, His-SUMO-Tag (Orofacial Cleft 1 Candidate Gene 1 Protein)

Catalog Number: USB-374528
Article Name: OFCC1, Recombinant, Human, aa3-231, His-SUMO-Tag (Orofacial Cleft 1 Candidate Gene 1 Protein)
Biozol Catalog Number: USB-374528
Supplier Catalog Number: 374528
Alternative Catalog Number: USB-374528-20,USB-374528-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa3-231 from human OFCC1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.5kD Amino Acid Sequence: REKFQQKALKQTKQKKSKSAEFLMVKEDREATEGTGNPAFNMSSPDLSACQTAEKKVIRHDMPDRTLAAHQQKFRLP
Molecular Weight: 42.5
UniProt: Q8IZS5
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol.