OTC, Recombinant, Mouse, aa33-354, His-SUMO-Tag (Ornithine Carbamoyltransferase, Mitochondrial)

Catalog Number: USB-374569
Article Name: OTC, Recombinant, Mouse, aa33-354, His-SUMO-Tag (Ornithine Carbamoyltransferase, Mitochondrial)
Biozol Catalog Number: USB-374569
Supplier Catalog Number: 374569
Alternative Catalog Number: USB-374569-20,USB-374569-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa33-354 from mouse Otc, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.1kD Amino Acid Sequence: SQVQLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSF
Molecular Weight: 52.1
UniProt: P11725
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol.