OTC, Recombinant, Mouse, aa33-354, His-SUMO-Tag (Ornithine Carbamoyltransferase, Mitochondrial)

Product Overview

• Article Name: OTC, Recombinant, Mouse, aa33-354, His-SUMO-Tag (Ornithine Carbamoyltransferase, Mitochondrial)
• Biozol Catalog Number: USB-374569
• Supplier Catalog Number: 374569
• Alternative Catalog Number: USB-374569-20,USB-374569-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa33-354 from mouse Otc, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.1kD Amino Acid Sequence: SQVQLKGRDLLTLKNFTGEEIQYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPSF

Product Properties

• Molecular Weight: 52.1
• UniProt: P11725
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.