PAI2, Recombinant, Rat, aa1-416, His-Tag (Plasminogen Activator Inhibitor 2 Type A, Serpinb2)

Product Overview

• Article Name: PAI2, Recombinant, Rat, aa1-416, His-Tag (Plasminogen Activator Inhibitor 2 Type A, Serpinb2)
• Biozol Catalog Number: USB-374600
• Supplier Catalog Number: 374600
• Alternative Catalog Number: USB-374600-20,USB-374600-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Inhibits urokinase-type plasminogen activator. Source: Recombinant protein corresponding to aa1-416 from rat PAI2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~49.2kD Amino Acid Sequence: MEELSMANTMFALNLLKQIEQSNSTQNIFISPWSISSTLA

Product Properties

• Molecular Weight: 49.2
• UniProt: P29524
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.