Pectate Lyase 1, Recombinant, Short Ragweed, aa26-398, His-Tag

Product Overview

• Article Name: Pectate Lyase 1, Recombinant, Short Ragweed, aa26-398, His-Tag
• Biozol Catalog Number: USB-374664
• Supplier Catalog Number: 374664
• Alternative Catalog Number: USB-374664-20,USB-374664-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Has pectate lyase activity. Source: Recombinant protein corresponding to aa26-398 from short ragweed Pectate lyase 1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~42.8kD Amino Acid Sequence: AEDVEEFLPSANETRRSLKACEAHNIIDKCWRCKADW

Product Properties

• Molecular Weight: 42.8
• UniProt: P27760
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.