PHGDH, Recombinant, Human, aa2-251, GST-Tag (D-3-phosphoglycerate Dehydrogenase)

Product Overview

• Article Name: PHGDH, Recombinant, Human, aa2-251, GST-Tag (D-3-phosphoglycerate Dehydrogenase)
• Biozol Catalog Number: USB-374686
• Supplier Catalog Number: 374686
• Alternative Catalog Number: USB-374686-20,USB-374686-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa2-251 from human PHGDH, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.8kD Amino Acid Sequence: AFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNV

Product Properties

• Molecular Weight: 53.8
• UniProt: O43175
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.