PHPT1, Recombinant, Human, aa1-125, GST-Tag (14kD Phosphohistidine Phosphatase)

Product Overview

• Article Name: PHPT1, Recombinant, Human, aa1-125, GST-Tag (14kD Phosphohistidine Phosphatase)
• Biozol Catalog Number: USB-374697
• Supplier Catalog Number: 374697
• Alternative Catalog Number: USB-374697-20,USB-374697-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Exhibits phosphohistidine phosphatase activity. Source: Recombinant protein corresponding to aa1-125 from human PHPT1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.8kD Amino Acid Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSG

Product Properties

• Molecular Weight: 40.8
• UniProt: Q9NRX4
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.