PHPT1, Recombinant, Human, aa1-125, His-Tag (14kD Phosphohistidine Phosphatase)

Product Overview

• Article Name: PHPT1, Recombinant, Human, aa1-125, His-Tag (14kD Phosphohistidine Phosphatase)
• Biozol Catalog Number: USB-374698
• Supplier Catalog Number: 374698
• Alternative Catalog Number: USB-374698-20,USB-374698-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Exhibits phosphohistidine phosphatase activity. Source: Recombinant protein corresponding to aa1-125 from human PHPT1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.8kD Amino Acid Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAP

Product Properties

• Molecular Weight: 15.8
• UniProt: Q9NRX4
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.