PHYH, Recombinant, Human, aa1-338, GST-Tag (Phytanoyl-CoA Dioxygenase, Peroxisomal)

Product Overview

• Article Name: PHYH, Recombinant, Human, aa1-338, GST-Tag (Phytanoyl-CoA Dioxygenase, Peroxisomal)
• Biozol Catalog Number: USB-374701
• Supplier Catalog Number: 374701
• Alternative Catalog Number: USB-374701-20,USB-374701-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Source: Recombinant protein corresponding to aa1-338 from human PHYH, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~62.4kD Amino Acid Sequence: SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEE

Product Properties

• Molecular Weight: 62.4
• UniProt: O14832
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.