PISD, Recombinant, Human, aa1-375, His-SUMO-Tag (Phosphatidylserine Decarboxylase Proenzyme)

Product Overview

• Article Name: PISD, Recombinant, Human, aa1-375, His-SUMO-Tag (Phosphatidylserine Decarboxylase Proenzyme)
• Biozol Catalog Number: USB-374714
• Supplier Catalog Number: 374714
• Alternative Catalog Number: USB-374714-20,USB-374714-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-375 from human PISD, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~59.0kD Amino Acid Sequence: MMCQSEARQGPELRAAKWLHFPQLALRRRLGQLSCMSRPALKLRSWPLTVLYYLLPFGALRPLSRVGWRPVSRVALYK

Product Properties

• Molecular Weight: 59
• UniProt: Q9UG56
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.