PKLR, Recombinant, Human, aa1-574, His-Tag (Pyruvate Kinase Isozymes R/L)

Catalog Number: USB-374717
Article Name: PKLR, Recombinant, Human, aa1-574, His-Tag (Pyruvate Kinase Isozymes R/L)
Biozol Catalog Number: USB-374717
Supplier Catalog Number: 374717
Alternative Catalog Number: USB-374717-20,USB-374717-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-574 from human PKLR, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~65.8kD Amino Acid Sequence: MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPV
Molecular Weight: 65.8
UniProt: P30613
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol.