PKLR, Recombinant, Human, aa1-574, His-Tag (Pyruvate Kinase PKLR)

Product Overview

• Article Name: PKLR, Recombinant, Human, aa1-574, His-Tag (Pyruvate Kinase PKLR)
• Biozol Catalog Number: USB-374718
• Supplier Catalog Number: 374718
• Alternative Catalog Number: USB-374718-20,USB-374718-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays a key role in glycolysis. Source: Recombinant protein corresponding to aa1-574 from human PKLR, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~63.83kD Amino Acid Sequence: MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQLTQELG

Product Properties

• Molecular Weight: 63.83
• UniProt: P30613
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.