Pklr, Recombinant, Rat, aa1-574, His-Tag (Pyruvate Kinase Isozymes R/L)

Product Overview

• Article Name: Pklr, Recombinant, Rat, aa1-574, His-Tag (Pyruvate Kinase Isozymes R/L)
• Biozol Catalog Number: USB-374719
• Supplier Catalog Number: 374719
• Alternative Catalog Number: USB-374719-20,USB-374719-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays a key role in glycolysis. Source: Recombinant protein corresponding to aa1-574 from rat Pklr, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~66.2kD Amino Acid Sequence: MSVQENTLPQQLWPWIFRSQKDLAKSALSGAPGGPAGYLRRASVAQLTQELGT

Product Properties

• Molecular Weight: 66.2
• UniProt: P12928
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.