PLD4, Recombinant, Human, aa52-506, His-SUMO-Tag (Phospholipase D4)

Catalog Number: USB-374746
Article Name: PLD4, Recombinant, Human, aa52-506, His-SUMO-Tag (Phospholipase D4)
Biozol Catalog Number: USB-374746
Supplier Catalog Number: 374746
Alternative Catalog Number: USB-374746-20,USB-374746-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa52-506 from human PLD4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~66.0kD Amino Acid Sequence: WQVPRPPTWGQVQPKDVPRSWEHGSSPAWEPLEAEARQQRDSCQLVLVESIPQDLPSAAGSPSAQPLGQAWLQLLDT
Molecular Weight: 66
UniProt: Q96BZ4
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol.