PLD5, Recombinant, Human, aa92-536, His-SUMO-Tag (Inactive Phospholipase D5)

Product Overview

• Article Name: PLD5, Recombinant, Human, aa92-536, His-SUMO-Tag (Inactive Phospholipase D5)
• Biozol Catalog Number: USB-374747
• Supplier Catalog Number: 374747
• Alternative Catalog Number: USB-374747-20,USB-374747-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa92-536 from human PLD5, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~66.8kD Amino Acid Sequence: MGEDEDGLSEKNCQNKCRIALVENIPEGLNYSENAPFHLSLFQGWMNLLNMAKKSVDIVSSHWDLNHTHPSACQGQR

Product Properties

• Molecular Weight: 66.8
• UniProt: Q8N7P1
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.