PmpD, Recombinant, Chlamydia Trachomatis, aa1244-1531, His-SUMO-Tag (Probable Outer Membrane Protein pmpD)

Product Overview

• Article Name: PmpD, Recombinant, Chlamydia Trachomatis, aa1244-1531, His-SUMO-Tag (Probable Outer Membrane Protein pmpD)
• Biozol Catalog Number: USB-374769
• Supplier Catalog Number: 374769
• Alternative Catalog Number: USB-374769-20,USB-374769-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1244-1531 from chlamydia trachomatis pmpD, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~47.5kD Amino Acid Sequence: EFDYSTNVWGFAFGGFRTLSAENLVAIDGYKGAYGGASAGVDIQLMEDFVLGVSGAAFL

Product Properties

• Molecular Weight: 47.5
• UniProt: O84818
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.