PolA, Recombinant, Thermus Aquaticus, aa287-832, GST-Tag (DNA Polymerase I, Thermostable)

Product Overview

• Article Name: PolA, Recombinant, Thermus Aquaticus, aa287-832, GST-Tag (DNA Polymerase I, Thermostable)
• Biozol Catalog Number: USB-374782
• Supplier Catalog Number: 374782
• Alternative Catalog Number: USB-374782-20,USB-374782-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa287-832 from thermus aquaticus DNA Polymerase I, Thermostable, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~61.5kD Amino Acid Sequence: LLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARG

Product Properties

• Molecular Weight: 61.5
• UniProt: P19821
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.