PolA, Recombinant, Thermus Aquaticus, aa571-832, GST-Tag (DNA Polymerase I, Thermostable, )

Product Overview

• Article Name: PolA, Recombinant, Thermus Aquaticus, aa571-832, GST-Tag (DNA Polymerase I, Thermostable, )
• Biozol Catalog Number: USB-374786
• Supplier Catalog Number: 374786
• Alternative Catalog Number: USB-374786-20,USB-374786-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa571-832 from thermus aquaticus DNA Polymerase I, Thermostable, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~88.7kD Amino Acid Sequence: TGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQ

Product Properties

• Molecular Weight: 88.7
• UniProt: P19821
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.