PPAN, Recombinant, Human, aa1-473, His-Tag (Suppressor of SWI4 1 Homolog)

Product Overview

• Article Name: PPAN, Recombinant, Human, aa1-473, His-Tag (Suppressor of SWI4 1 Homolog)
• Biozol Catalog Number: USB-374808
• Supplier Catalog Number: 374808
• Alternative Catalog Number: USB-374808-20,USB-374808-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May have a role in cell growth. Source: Recombinant protein corresponding to aa1-473 from human PPAN, fused to His-Tag at N-terminal expressed in Yeast. Molecular Weight: ~55.2kD Amino Acid Sequence: MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVM

Product Properties

• Molecular Weight: 55.2
• UniProt: Q9NQ55
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.