PTP3, Recombinant, Nosema bombycis, aa710-1320, GST-Tag (Polar Tube Protein 3)

Product Overview

• Article Name: PTP3, Recombinant, Nosema bombycis, aa710-1320, GST-Tag (Polar Tube Protein 3)
• Biozol Catalog Number: USB-374928
• Supplier Catalog Number: 374928
• Alternative Catalog Number: USB-374928-20,USB-374928-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa710-1320 from Nosema bombycis PTP3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~93.7kD Amino Acid Sequence: DEYSIDRSVIKFPLKTFIDEEVSNVGEAYVKNKKQSINDEVRNKVTTTNVNSGLNVIETENGFLNLGENS

Product Properties

• Molecular Weight: 93.7
• UniProt: R0KX08
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.