PTPRR, Recombinant, Human, aa1-412, His-SUMO-Tag (PTPRR, protein)

Product Overview

• Article Name: PTPRR, Recombinant, Human, aa1-412, His-SUMO-Tag (PTPRR, protein)
• Biozol Catalog Number: USB-374939
• Supplier Catalog Number: 374939
• Alternative Catalog Number: USB-374939-20,USB-374939-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-412 from human PTPRR, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~62.6kD Amino Acid Sequence: MILHRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVC

Product Properties

• Molecular Weight: 62.6
• UniProt: Q05B41
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.