PYCR1, Recombinant, Human, aa1-171, His-SUMO-Tag (Pyrroline-5-carboxylate Reductase 1, Mitochondrial)

Catalog Number: USB-374950
Article Name: PYCR1, Recombinant, Human, aa1-171, His-SUMO-Tag (Pyrroline-5-carboxylate Reductase 1, Mitochondrial)
Biozol Catalog Number: USB-374950
Supplier Catalog Number: 374950
Alternative Catalog Number: USB-374950-20,USB-374950-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-171 from human PYCR1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.7kD Amino Acid Sequence: MEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPG
Molecular Weight: 33.7
UniProt: Q8TBX0
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol.