RBKS, Recombinant, Human, aa2-322, His-SUMO-Tag (Ribokinase)

Product Overview

• Article Name: RBKS, Recombinant, Human, aa2-322, His-SUMO-Tag (Ribokinase)
• Biozol Catalog Number: USB-375000
• Supplier Catalog Number: 375000
• Alternative Catalog Number: USB-375000-20,USB-375000-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa2-322 from human RBKS, fused to His-SUMO-Tag at N-termnal, expressed in E. coli. Molecular Weight: ~50kD Amino Acid Sequence: AASGEPQRQWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGN

Product Properties

• Molecular Weight: 50
• UniProt: Q9H477
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.