RMND5A, Recombinant, Human, His-SUMO-Tag (Protein RMD5 Homolog A)

Product Overview

• Article Name: RMND5A, Recombinant, Human, His-SUMO-Tag (Protein RMD5 Homolog A)
• Biozol Catalog Number: USB-375070
• Supplier Catalog Number: 375070
• Alternative Catalog Number: USB-375070-20,USB-375070-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-385 from human RMND5A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~59.3kD Amino Acid Sequence: MDQCVTVERELEKVLHKFSGYGQLCERGLEELIDYTGGLKHEILQSHGQDAELSGTLSLVLTQCCKRIKDTVQKLA

Product Properties

• Molecular Weight: 59.3
• UniProt: Q9H871
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.