ROPN1B, Recombinant, Human, aa1-120, GST-Tag (Ropporin-1B)

Product Overview

• Article Name: ROPN1B, Recombinant, Human, aa1-120, GST-Tag (Ropporin-1B)
• Biozol Catalog Number: USB-375080
• Supplier Catalog Number: 375080
• Alternative Catalog Number: USB-375080-20,USB-375080-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-120 from human ROPN1B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.6kD Amino Acid Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDG

Product Properties

• Molecular Weight: 40.6
• UniProt: Q9BZX4
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.