SCRG1, Recombinant, Human, aa21-98, His-Tag (Scrapie-responsive Protein 1)

Product Overview

• Article Name: SCRG1, Recombinant, Human, aa21-98, His-Tag (Scrapie-responsive Protein 1)
• Biozol Catalog Number: USB-375226
• Supplier Catalog Number: 375226
• Alternative Catalog Number: USB-375226-20,USB-375226-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa21-98 from human SCRG1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.9kD AA Sequence: MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ Storage and S

Product Properties

• Molecular Weight: 10.9
• UniProt: O75711
• Purity: ~90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.