SDF2, Recombinant, Human, aa19-211, His-Tag (Stromal Cell-derived Factor 2)

Product Overview

• Article Name: SDF2, Recombinant, Human, aa19-211, His-Tag (Stromal Cell-derived Factor 2)
• Biozol Catalog Number: USB-375233
• Supplier Catalog Number: 375233
• Alternative Catalog Number: USB-375233-20,USB-375233-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa19-211 from human SDF2, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.3kD Amino Acid Sequence: SSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTG

Product Properties

• Molecular Weight: 25.3
• UniProt: Q99470
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.