Sec16A, Recombinant, Human, aa1943-2154, His-Tag (Transport protein SEC16A)

Catalog Number: USB-375239
Article Name: Sec16A, Recombinant, Human, aa1943-2154, His-Tag (Transport protein SEC16A)
Biozol Catalog Number: USB-375239
Supplier Catalog Number: 375239
Alternative Catalog Number: USB-375239-20,USB-375239-100,USB-375239-1
Manufacturer: US Biological
Category: Molekularbiologie
Defines endoplasmic reticulum exit sites (ERES) and is required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining an ERES. Required for normal transitional endoplasmic reticulum (tER) organization. Source: Recombinant protein corresponding to aa1943-2154 from human Sec16A, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.1kD Amino Acid Sequence: AYLPDDKNKSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSMPKTVQAAPPALPGPPGAPVNMYSRRAAGTRARYVDVLNPSGTQRSEPALAPADFVAPLAPLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKVLSSAASLPGSELPSSRPEGSQGGELSRCSSMSSLSREVSQHFNQAPGDLPAAGGPPSGAMPFYNPAQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.1
UniProt: O15027
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.