Serine Protease 29, Recombinant, Mouse, aa18-179, His-B2M-Tag (Prss29)

Product Overview

• Article Name: Serine Protease 29, Recombinant, Mouse, aa18-179, His-B2M-Tag (Prss29)
• Biozol Catalog Number: USB-375257
• Supplier Catalog Number: 375257
• Alternative Catalog Number: USB-375257-20,USB-375257-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Involved in embryo hatching and implantation. Source: Recombinant protein corresponding to aa18-179 from mouse Prss29, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.9kD Amino Acid Sequence: GTPAPGPEDVLMGIVGGHSAPQGKWPWQVS

Product Properties

• Molecular Weight: 31.9
• UniProt: Q99MS4
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.