Serpinb2, Recombinant, Rat, aa1-417, His-SUMO-Tag (Plasminogen Activator Inhibitor 2 Type A)

Product Overview

• Article Name: Serpinb2, Recombinant, Rat, aa1-417, His-SUMO-Tag (Plasminogen Activator Inhibitor 2 Type A)
• Biozol Catalog Number: USB-375268
• Supplier Catalog Number: 375268
• Alternative Catalog Number: USB-375268-20,USB-375268-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Recombinant protein corresponding to aa1-417 from rat Serpinb2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~63.2kD Amino Acid Sequence: MEELSMANTMFALNLLKQIEQSNSTQNIFISPWSISSTLAIVFLGAQANTEEQMAKVLNFDKIGSYDLTPGNPENF

Product Properties

• Molecular Weight: 63.2
• UniProt: P29524
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.