SERPINB9, Recombinant, Human, aa1-376, GST-Tag (Serpin B9)

Product Overview

• Article Name: SERPINB9, Recombinant, Human, aa1-376, GST-Tag (Serpin B9)
• Biozol Catalog Number: USB-375270
• Supplier Catalog Number: 375270
• Alternative Catalog Number: USB-375270-20,USB-375270-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Granzyme B inhibitor. Source: Recombinant protein corresponding to aa1-376 from human SERPINB9, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~69.4kD Amino Acid Sequence: METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQA

Product Properties

• Molecular Weight: 69.4
• UniProt: P50453
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.