SLC25A30, Recombinant, Human, aa1-291, His-SUMO-Tag (Kidney Mitochondrial Carrier Protein 1)

Product Overview

• Article Name: SLC25A30, Recombinant, Human, aa1-291, His-SUMO-Tag (Kidney Mitochondrial Carrier Protein 1)
• Biozol Catalog Number: USB-375317
• Supplier Catalog Number: 375317
• Alternative Catalog Number: USB-375317-20,USB-375317-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Probable transporter. Source: Recombinant protein corresponding to aa1-291 from human SLC25A30, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.5kD Amino Acid Sequence: MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGM

Product Properties

• Molecular Weight: 48.5
• UniProt: Q5SVS4
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a liquid in Tris, 50% glycerol.